BRD1 polyclonal antibody View larger

BRD1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BRD1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about BRD1 polyclonal antibody

Brand: Abnova
Reference: PAB20028
Product name: BRD1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant BRD1.
Isotype: IgG
Gene id: 23774
Gene name: BRD1
Gene alias: BRL|BRPF1|BRPF2|DKFZp686F0325
Gene description: bromodomain containing 1
Immunogen: Recombinant protein corresponding to amino acids of human BRD1.
Immunogen sequence/protein sequence: IAAEVGQSSMWISTDAAASVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVHGEPTSD
Protein accession: O95696
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20028-49-187-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251 MG with BRD1 polyclonal antibody (Cat # PAB20028) at 1-4 ug/mL dilution shows positivity in nucleus.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy BRD1 polyclonal antibody now

Add to cart