CCDC117 polyclonal antibody View larger

CCDC117 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCDC117 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about CCDC117 polyclonal antibody

Brand: Abnova
Reference: PAB20002
Product name: CCDC117 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CCDC117.
Isotype: IgG
Gene id: 150275
Gene name: CCDC117
Gene alias: FLJ33814|dJ366L4.1
Gene description: coiled-coil domain containing 117
Immunogen: Recombinant protein corresponding to amino acids of human CCDC117.
Immunogen sequence/protein sequence: GHGVNPSVSGLSIPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDEDEEVEADRNVNHLPSLVLSDTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNTKNYTGESQAKHVAAGTAFPQRTEL
Protein accession: Q8IWD4
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20002-48-47-1.jpg
Application image note: Immunohistochemical staining of human adrenal gland with CCDC117 polyclonal antibody (Cat # PAB20002) shows strong nuclear positivity in cortical cells at 1:500-1:1000 dilution.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CCDC117 polyclonal antibody now

Add to cart