Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GST purified rabbit polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Host species | Rabbit |
| Applications | ELISA,WB-Re |
More info about GST purified rabbit polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB1625-E01P |
| Product name: | GST purified rabbit polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against GST protein. |
| Genbank accession: | U78874.1 |
| Immunogen: | GST protein. ( 242 a.a protein modified from AAB37352, please see the protein seq for the actual immunogen sequence. ) |
| Immunogen sequence/protein sequence: | MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV* |
| Protein accession: | AAB37352 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against recombinant protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (26.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Chaperonin-Containing t-Complex Protein-1 Subunitβ as a Possible Biomarker for the Phase of Glomerular Hyperfiltration of Diabetic Nephropathy.Wu CA, Chang LC, Lin YF, Hung YJ, Pei D, Chen JS. Disease Markers Volume 2015 (2015), Article ID 548101, 7 pages |