Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Myt1l polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Mouse |
| Host species | Rabbit |
| Applications | WB-Re |
More info about Myt1l polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15836 |
| Product name: | Myt1l polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Myt1l. |
| Gene id: | 17933 |
| Gene name: | Myt1l |
| Gene alias: | 2900046C06Rik|2900093J19Rik|C630034G21Rik|Nztf1|Pmng1|Png-1|mKIAA1106 |
| Gene description: | myelin transcription factor 1-like |
| Immunogen: | Recombinant GST fusion protein corresponding to 154 amino acids of mouse Myt1l. |
| Immunogen sequence/protein sequence: | RATSAMKKAKLSGEQMLTIKQRASNGIENDEEIKQLDEEIKELNESNSQMEADMIKLRTQITTMESNLKTIEEENKVIEQQNESLLHELANLSQSLIHSLANIQLPHMDPINEQNFDAYVTTLTEMYTNQDRYQSPENKALLENIKQAVRGIQV |
| Protein accession: | AB093283 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX0194. This antibody detects mMYT1L protein. |
| Reactivity: | Mouse |
| Application image: |  |
| Application image note: | Western blot analysis bacterial lysate of MBP-fused antigen protein by using Myt1l polyclonal antibody (Cat. PAB15836). |
| Applications: | WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Neutralization of terminal differentiation in gliomagenesis.Hu J, Ho AL, Yuan L, Hu B, Hua S, Hwang SS, Zhang J, Hu T, Zheng H, Gan B, Wu G, Wang YA, Chin L, Depinho RA Proc Natl Acad Sci U S A. 2013 Aug 5. |