Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Xpo5 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Mouse |
| Host species | Rabbit |
| Applications | WB |
More info about Xpo5 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB15694 |
| Product name: | Xpo5 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant Xpo5. |
| Gene id: | 72322 |
| Gene name: | Xpo5 |
| Gene alias: | 2410004H11Rik|2700038C24Rik|AI648907|AW549301|Exp5|RanBp21|mKIAA1291 |
| Gene description: | exportin 5 |
| Immunogen: | Recombinant GST fusion protein corresponding to 108 mouse Xpo5. |
| Immunogen sequence/protein sequence: | AFQIYEALRPRYLEIRAVMEQIPEINKESLDQFDCKLLNPSLQKAADKRRKDHFKRLIAGCIGKPLGEQFRKEVHIKNLPWLFKKPKPMLETEVLDSEEGGLATIFEP |
| Protein accession: | AK122486 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS (50% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Mouse |
| Specificity: | Specific to recombinant protein GX1085. This antibody detects endogenous mXPO5 protein in several cell types. |
| Reactivity: | Mouse |
| Applications: | WB |
| Shipping condition: | Dry Ice |
| Publications: | Exp5 exports eEF1A via tRNA from nuclei and synergizes with other transport pathways to confine translation to the cytoplasm.Bohnsack MT, Regener K, Schwappach B, Saffrich R, Paraskeva E, Hartmann E, Gorlich D. EMBO J. 2002 Nov 15;21(22):6205-15. |