PPA1 (Human) Recombinant Protein View larger

PPA1 (Human) Recombinant Protein

New product

359,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPA1 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about PPA1 (Human) Recombinant Protein

Brand: Abnova
Reference: P4908
Product name: PPA1 (Human) Recombinant Protein
Product description: Human PPA1 (NP_066952, 1 a.a. - 289 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Gene id: 5464
Gene name: PPA1
Gene alias: IOPPP|MGC111556|PP|PP1|SID6-8061
Gene description: pyrophosphatase (inorganic) 1
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMGSHMSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN
Protein accession: NP_066952
Form: Liquid
Concentration: 0.5 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM Tris-HCl, , 200 mM NaCl, pH 8.0 (2 mM DTT, 20% glycerol)
Storage instruction: Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 15% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-P4908-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy PPA1 (Human) Recombinant Protein now

Add to cart