Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | SDS-PAGE |
Brand: | Abnova |
Reference: | P4123 |
Product name: | APOE (Human) Recombinant Protein |
Product description: | Human APOE (NP_000032.1, 299 amino acids) partial recombinant protein expressed in Escherichia coli. |
Gene id: | 348 |
Gene name: | APOE |
Gene alias: | AD2|LPG|MGC1571|apoprotein |
Gene description: | apolipoprotein E |
Genbank accession: | NM_000041 |
Immunogen sequence/protein sequence: | MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH |
Protein accession: | NP_000032.1 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Storage buffer: | Lyophilized from 20mM sodium phosphate |
Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with 5 mM sodium phosphate pH 7.8 containing 0.5 mM DTT, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | SDS-PAGE |
Shipping condition: | Dry Ice |