IGF1 (Human) Recombinant Protein View larger

IGF1 (Human) Recombinant Protein

New product

309,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IGF1 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about IGF1 (Human) Recombinant Protein

Brand: Abnova
Reference: P3452
Product name: IGF1 (Human) Recombinant Protein
Product description: Human IGF1 (NP_000609, 49 a.a. - 118 a.a.) partial recombinant protein expressed in Escherichia coli.
Gene id: 3479
Gene name: IGF1
Gene alias: IGFI
Gene description: insulin-like growth factor 1 (somatomedin C)
Immunogen sequence/protein sequence: MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Protein accession: NP_000609
Form: Liquid
Concentration: 1 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In PBS, pH 7.4
Storage instruction: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 3 ug protein in 15% SDS-PAGE
Quality control testing picture: qc_test-P3452-1.jpg
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy IGF1 (Human) Recombinant Protein now

Add to cart