Brand | Abnova |
Product type | Proteins |
Reactivity | Human |
Host species | Fungi |
Applications | SDS-PAGE |
Brand: | Abnova |
Reference: | P6169 |
Product name: | GZMA (Human) Recombinant Protein |
Product description: | Human GZMA (P12544) partial recombinant protein expressed in Pichia pastoris. |
Gene id: | 3001 |
Gene name: | GZMA |
Gene alias: | CTLA3|HFSP |
Gene description: | granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) |
Immunogen sequence/protein sequence: | EKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV |
Protein accession: | P12544 |
Form: | Liquid |
Preparation method: | Pichia pastoris expression system |
Recommend dilutions: | SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS |
Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Tag: | None |
Product type: | Proteins |
Host species: | Fungi |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | SDS-PAGE |
Shipping condition: | Dry Ice |