Brand | Abnova |
Product type | Proteins |
Reactivity | Mouse |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P6164 |
Product name: | Nog (Mouse) Recombinant protein |
Product description: | Mouse Nog (homodimer) (P97466) partial recombinant protein expressed in Escherichia coli. |
Gene id: | 18121 |
Gene name: | Nog |
Gene alias: | - |
Gene description: | noggin |
Immunogen sequence/protein sequence: | MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
Protein accession: | P97466 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein. |
Storage instruction: | Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Due to solubility reasons the protein should be kept at low pH. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C. |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Mouse |
Reactivity: | Mouse |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |