CCL25 (Human) Recombinant protein View larger

CCL25 (Human) Recombinant protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCL25 (Human) Recombinant protein

BrandAbnova
Product typeProteins
ReactivityHuman
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about CCL25 (Human) Recombinant protein

Brand: Abnova
Reference: P6162
Product name: CCL25 (Human) Recombinant protein
Product description: Human CCL25 (O15444) partial recombinant protein expressed in Escherichia coli.
Gene id: 6370
Gene name: CCL25
Gene alias: Ckb15|MGC150327|SCYA25|TECK
Gene description: chemokine (C-C motif) ligand 25
Immunogen sequence/protein sequence: QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNMQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSRKNVSLLISANSGL
Protein accession: O15444
Form: Lyophilized
Preparation method: Escherichia coli expression system
Recommend dilutions: Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage buffer: Lyophilized from 10mM Acetic Acid.
Storage instruction: Store at -20°C.
Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Reactivity: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy CCL25 (Human) Recombinant protein now

Add to cart