Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CD34 (Human) Recombinant protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Host species | Hamster |
| Applications | SDS-PAGE |
More info about CD34 (Human) Recombinant protein
| Brand: | Abnova |
| Reference: | P6146 |
| Product name: | CD34 (Human) Recombinant protein |
| Product description: | Human CD34 (P28906) partial recombinant protein expressed in CHO cells. |
| Gene id: | 947 |
| Gene name: | CD34 |
| Gene alias: | - |
| Gene description: | CD34 molecule |
| Immunogen sequence/protein sequence: | LDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT |
| Protein accession: | P28906 |
| Form: | Lyophilized |
| Preparation method: | Mammalian cell (CHO) expression system |
| Recommend dilutions: | SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from 10 mM Sodium Phosphate, pH 7.5. |
| Storage instruction: | Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Hamster |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |