TNFSF8 (Human) Recombinant protein View larger

TNFSF8 (Human) Recombinant protein

New product

439,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFSF8 (Human) Recombinant protein

BrandAbnova
Product typeProteins
ReactivityHuman
Host speciesHamster
ApplicationsFunc,SDS-PAGE

More info about TNFSF8 (Human) Recombinant protein

Brand: Abnova
Reference: P6145
Product name: TNFSF8 (Human) Recombinant protein
Product description: Human TNFSF8 (P32971) patial recombinant protein with His-tag expressed in CHO cells.
Gene id: 944
Gene name: TNFSF8
Gene alias: CD153|CD30L|CD30LG|MGC138144
Gene description: tumor necrosis factor (ligand) superfamily, member 8
Immunogen sequence/protein sequence: HHHHHHHHPSPGGSGGQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Protein accession: P32971
Form: Lyophilized
Preparation method: Mammalian cell (CHO) expression system
Recommend dilutions: Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage buffer: Lyophilized from 1x PBS.
Storage instruction: Store at -20°C.
Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Tag: His
Product type: Proteins
Host species: Hamster
Antigen species / target species: Human
Reactivity: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy TNFSF8 (Human) Recombinant protein now

Add to cart