CD14 (Human) Recombinant protein View larger

CD14 (Human) Recombinant protein

New product

439,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD14 (Human) Recombinant protein

BrandAbnova
Product typeProteins
ReactivityHuman
Host speciesHuman
ApplicationsFunc,SDS-PAGE

More info about CD14 (Human) Recombinant protein

Brand: Abnova
Reference: P6141
Product name: CD14 (Human) Recombinant protein
Product description: Human CD14 (P08571) partial recombinant protein expressed in HEK293 cells.
Gene id: 929
Gene name: CD14
Gene alias: -
Gene description: CD14 molecule
Immunogen sequence/protein sequence: TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVP
Protein accession: P08571
Form: Lyophilized
Preparation method: Mammalian cell (HEK293) expression system
Recommend dilutions: Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage buffer: Lyophilized from 10mM Sodium Phosphate, pH 7.5.
Storage instruction: Store at -20°C.
Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Tag: None
Product type: Proteins
Host species: Human
Antigen species / target species: Human
Reactivity: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy CD14 (Human) Recombinant protein now

Add to cart