RSPO2 (Human) Recombinant protein View larger

RSPO2 (Human) Recombinant protein

New product

439,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RSPO2 (Human) Recombinant protein

BrandAbnova
Product typeProteins
ReactivityHuman
Host speciesHamster
ApplicationsFunc,SDS-PAGE

More info about RSPO2 (Human) Recombinant protein

Brand: Abnova
Reference: P6138
Product name: RSPO2 (Human) Recombinant protein
Product description: Human RSPO2 (Q6UXX9) partial recombinant protein expressed in CHO cells.
Gene id: 340419
Gene name: RSPO2
Gene alias: CRISTIN2|MGC35555|MGC43342
Gene description: R-spondin 2 homolog (Xenopus laevis)
Immunogen sequence/protein sequence: ASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPGGKRTPKAKEKRNKKKKRKLIERAQEQHSVFLATDRANQ
Protein accession: Q6UXX9
Form: Lyophilized
Preparation method: Mammalian cell (CHO) expression system
Recommend dilutions: Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage buffer: Lyophilized from 10 mM Sodium Phosphate (pH 7.5, 150 mM NaCl).
Storage instruction: Store at -20°C.
Reconstitute in water to a concentration of 0.1-0.5 mg/mL. Do not vortex.
For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Tag: None
Product type: Proteins
Host species: Hamster
Antigen species / target species: Human
Reactivity: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy RSPO2 (Human) Recombinant protein now

Add to cart