RSPO1 (Human) Recombinant protein View larger

RSPO1 (Human) Recombinant protein

New product

439,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RSPO1 (Human) Recombinant protein

BrandAbnova
Product typeProteins
ReactivityHuman
Host speciesHamster
ApplicationsFunc,SDS-PAGE

More info about RSPO1 (Human) Recombinant protein

Brand: Abnova
Reference: P6137
Product name: RSPO1 (Human) Recombinant protein
Product description: Human RSPO1 (Q2MKA7) partial recombinant protein expressed in CHO cells.
Gene id: 284654
Gene name: RSPO1
Gene alias: CRISTIN3|FLJ40906|RSPO
Gene description: R-spondin homolog (Xenopus laevis)
Immunogen sequence/protein sequence: SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Protein accession: Q2MKA7
Form: Lyophilized
Preparation method: Mammalian cell (CHO) expression system
Recommend dilutions: Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage buffer: Lyophilized from 10mM Sodium Phosphate (pH 7.5, 150mM NaCl).
Storage instruction: Store at -20°C.
Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Tag: None
Product type: Proteins
Host species: Hamster
Antigen species / target species: Human
Reactivity: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy RSPO1 (Human) Recombinant protein now

Add to cart