Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PGF (Isoform 1) (Human) Recombinant protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about PGF (Isoform 1) (Human) Recombinant protein
| Brand: | Abnova |
| Reference: | P6134 |
| Product name: | PGF (Isoform 1) (Human) Recombinant protein |
| Product description: | Human PGF (homodimer) (P49763) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 5228 |
| Gene name: | PGF |
| Gene alias: | D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760 |
| Gene description: | placental growth factor |
| Immunogen sequence/protein sequence: | MLPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR |
| Protein accession: | P49763 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from 10mM Sodium Phosphate, pH 7.5. |
| Storage instruction: | Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |