TNFSF4 (Human) Recombinant protein View larger

TNFSF4 (Human) Recombinant protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFSF4 (Human) Recombinant protein

BrandAbnova
Product typeProteins
ReactivityHuman
Host speciesInsect
ApplicationsFunc,SDS-PAGE

More info about TNFSF4 (Human) Recombinant protein

Brand: Abnova
Reference: P6126
Product name: TNFSF4 (Human) Recombinant protein
Product description: Human TNFSF4 (P23510) partial recombinant protein expressed in Hi-5 Insect cells.
Gene id: 7292
Gene name: TNFSF4
Gene alias: CD134L|CD252|GP34|OX-40L|OX4OL|TXGP1
Gene description: tumor necrosis factor (ligand) superfamily, member 4
Immunogen sequence/protein sequence: QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Protein accession: P23510
Form: Lyophilized
Preparation method: Insect cell (Hi-5) expression system
Recommend dilutions: Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage buffer: Lyophilized from 10 mM Tris pH 8.5.
Storage instruction: Store at -20°C.
Reconstitute in water to a concentration of 0.5 mg/mL. Do not vortex.
For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
Tag: None
Product type: Proteins
Host species: Insect
Antigen species / target species: Human
Reactivity: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy TNFSF4 (Human) Recombinant protein now

Add to cart