Brand | Abnova |
Product type | Proteins |
Reactivity | Human |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P6124 |
Product name: | TNFRSF11B (Human) Recombinant protein |
Product description: | Human TNFRSF11B (O00300) partial recombinant protein expressed in Escherichia coli. |
Gene id: | 4982 |
Gene name: | TNFRSF11B |
Gene alias: | MGC29565|OCIF|OPG|TR1 |
Gene description: | tumor necrosis factor receptor superfamily, member 11b |
Immunogen sequence/protein sequence: | METFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQK |
Protein accession: | O00300 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage buffer: | Lyophilized from 10 mM Tris (pH 7.5, 75 mM NaCl). |
Storage instruction: | Store at -20°C. Reconstitute in 5 mM Tris, pH 7.5 to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C. |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |