Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Il1f5 (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Mouse |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about Il1f5 (Mouse) Recombinant Protein
| Brand: | Abnova |
| Reference: | P6097 |
| Product name: | Il1f5 (Mouse) Recombinant Protein |
| Product description: | Mouse Il1f5 (Q9QYY1) full-length recombinant protein expressed in E. coli. |
| Gene id: | 54450 |
| Gene name: | Il1f5 |
| Gene alias: | AI413231|FIL1delta|IL-1H3|IL1HY1 |
| Gene description: | interleukin 1 family, member 5 (delta) |
| Immunogen sequence/protein sequence: | VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD |
| Protein accession: | Q9QYY1 |
| Form: | Lyophilized |
| Preparation method: | E. coli expression system |
| Recommend dilutions: | SDS-PAGE Activity assay The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from 10mM Sodium Phosphate, pH 7.5. |
| Storage instruction: | Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Mouse |
| Reactivity: | Mouse |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |