Brand | Abnova |
Product type | Proteins |
Reactivity | Rat |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P6086 |
Product name: | Il13 (Rat) Recombinant Protein |
Product description: | Rat Il13 (P42203) partial recombinant protein expressed in E. coli. |
Gene id: | 116553 |
Gene name: | Il13 |
Gene alias: | - |
Gene description: | interleukin 13 |
Immunogen sequence/protein sequence: | VRRSTSPPVALRELIEELSNITQDQKTSLCNSSIVWSVDITAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH |
Protein accession: | P42203 |
Form: | Lyophilized |
Preparation method: | E. coli expression system |
Recommend dilutions: | SDS-PAGE Activity assay The optimal working dilution should be determined by the end user. |
Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein. |
Storage instruction: | Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C. |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Rat |
Reactivity: | Rat |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |