Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MIF (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human |
| Host species | Insect |
| Applications | Func,SDS-PAGE |
More info about MIF (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P6067 |
| Product name: | MIF (Human) Recombinant Protein |
| Product description: | Human MIF (P14174) partial recombinant protein expressed in Hi-5. |
| Gene id: | 4282 |
| Gene name: | MIF |
| Gene alias: | GIF|GLIF|MMIF |
| Gene description: | macrophage migration inhibitory factor (glycosylation-inhibiting factor) |
| Immunogen sequence/protein sequence: | HHHHHHHHAMPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
| Protein accession: | P14174 |
| Form: | Lyophlized |
| Preparation method: | Insect cell (Hi-5) expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein. |
| Storage instruction: | Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended. |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Insect |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |