Ccl4 (Mouse) Recombinant Protein View larger

Ccl4 (Mouse) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Ccl4 (Mouse) Recombinant Protein

BrandAbnova
Product typeProteins
ReactivityMouse
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about Ccl4 (Mouse) Recombinant Protein

Brand: Abnova
Reference: P6066
Product name: Ccl4 (Mouse) Recombinant Protein
Product description: Mouse Ccl4 (P12025) partial recombinant protein expressed in Escherichia coli.
Gene id: 17242
Gene name: Mdk
Gene alias: MK|Mek
Gene description: midkine
Immunogen sequence/protein sequence: VAKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD
Protein accession: P12025
Form: Lyophlized
Preparation method: Escherichia coli expression system
Recommend dilutions: Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein.
Storage instruction: Store at -20°C.
Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
For extended storage, it is recommended to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Mouse
Reactivity: Mouse
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy Ccl4 (Mouse) Recombinant Protein now

Add to cart