Brand | Abnova |
Product type | Proteins |
Reactivity | Mouse |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P6048 |
Product name: | TNFSF12 (Human) Recombinant Protein |
Product description: | Human TNFSF12 (O43508) partial recombinant protein expressed in Escherichia coli. |
Gene id: | 8742 |
Gene name: | TNFSF12 |
Gene alias: | APO3L|DR3LG|MGC129581|MGC20669|TWEAK |
Gene description: | tumor necrosis factor (ligand) superfamily, member 12 |
Immunogen sequence/protein sequence: | MKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
Protein accession: | O43508 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage buffer: | Lyophilized from sterile 10 mM Sodium Phosphate, pH 7.5 containing 0.1M L-Arginine |
Storage instruction: | Store at -20°C. Reconstitute in 10 mM Sodium Phosphate, pH 7.5 to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended. |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Reactivity: | Mouse |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |