TGFB2 (Human) Recombinant Protein View larger

TGFB2 (Human) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TGFB2 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
ReactivityMouse,Rat
Host speciesInsect
ApplicationsFunc,SDS-PAGE

More info about TGFB2 (Human) Recombinant Protein

Brand: Abnova
Reference: P6033
Product name: TGFB2 (Human) Recombinant Protein
Product description: Human TGFB2 (P61812) partial recombinant protein expressed in Hi-5 insect cells.
Gene id: 7042
Gene name: TGFB2
Gene alias: MGC116892|TGF-beta2
Gene description: transforming growth factor, beta 2
Immunogen sequence/protein sequence: ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Protein accession: P61812
Form: Lyophilized
Preparation method: Insect cell (Hi-5) expression system
Recommend dilutions: Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage buffer: Lyophilized from sterile Sodium Citrate, pH 3.5
Storage instruction: Store at -20°C.
Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
Tag: None
Product type: Proteins
Host species: Insect
Antigen species / target species: Human
Reactivity: Mouse,Rat
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy TGFB2 (Human) Recombinant Protein now

Add to cart