TGFB1 (Human) Recombinant Protein View larger

TGFB1 (Human) Recombinant Protein

New product

439,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TGFB1 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
ReactivityBovine,Chicken,Dog,Frog,Monkey,Mouse,Pig,Rabbit,Rat
Host speciesHamster
ApplicationsFunc,SDS-PAGE

More info about TGFB1 (Human) Recombinant Protein

Brand: Abnova
Reference: P6032
Product name: TGFB1 (Human) Recombinant Protein
Product description: Human TGFB1 (P01137) partial recombinant protein expressed in CHO cells.
Gene id: 7040
Gene name: TGFB1
Gene alias: CED|DPD1|TGFB|TGFbeta
Gene description: transforming growth factor, beta 1
Immunogen sequence/protein sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Protein accession: P01137
Form: Lyophilized
Preparation method: Mammalian cell (CHO) expression system
Recommend dilutions: Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage buffer: Lyophilized from sterile solution with no additives
Storage instruction: Store at -20°C.
Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
Tag: None
Product type: Proteins
Host species: Hamster
Antigen species / target species: Human
Reactivity: Bovine,Chicken,Dog,Frog,Monkey,Mouse,Pig,Rabbit,Rat
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy TGFB1 (Human) Recombinant Protein now

Add to cart