Brand | Abnova |
Product type | Proteins |
Reactivity | Bovine,Chicken,Dog,Frog,Monkey,Mouse,Pig,Rabbit,Rat |
Host species | Hamster |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P6032 |
Product name: | TGFB1 (Human) Recombinant Protein |
Product description: | Human TGFB1 (P01137) partial recombinant protein expressed in CHO cells. |
Gene id: | 7040 |
Gene name: | TGFB1 |
Gene alias: | CED|DPD1|TGFB|TGFbeta |
Gene description: | transforming growth factor, beta 1 |
Immunogen sequence/protein sequence: | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
Protein accession: | P01137 |
Form: | Lyophilized |
Preparation method: | Mammalian cell (CHO) expression system |
Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage buffer: | Lyophilized from sterile solution with no additives |
Storage instruction: | Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended. |
Tag: | None |
Product type: | Proteins |
Host species: | Hamster |
Antigen species / target species: | Human |
Reactivity: | Bovine,Chicken,Dog,Frog,Monkey,Mouse,Pig,Rabbit,Rat |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |