Hgf (Mouse) Recombinant Protein View larger

Hgf (Mouse) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Hgf (Mouse) Recombinant Protein

BrandAbnova
Product typeProteins
ReactivityMouse
Host speciesInsect
ApplicationsFunc,SDS-PAGE

More info about Hgf (Mouse) Recombinant Protein

Brand: Abnova
Reference: P6022
Product name: Hgf (Mouse) Recombinant Protein
Product description: Mouse Hgf (Q08048) full length recombinant protein expressed in Hi-5 (BTI-Tn-5B1-4) Insect cells.
Gene id: 15234
Gene name: Hgf
Gene alias: C230052L06Rik|HGF/SF|NK1|NK2|SF/HGF
Gene description: hepatocyte growth factor
Immunogen sequence/protein sequence: alpha chain:
QKKRRNTLHEFKKSAKTTLTKEDPLLKIKTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLYENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQTPHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDGAESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLR
Beta chain:
VVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPARNKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTIDLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESELCAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKVILTYKL
Protein accession: Q08048
Form: Lyophilized
Preparation method: Insect cell (Hi-5) expression system
Recommend dilutions: Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein
Storage instruction: Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Tag: None
Product type: Proteins
Host species: Insect
Antigen species / target species: Mouse
Reactivity: Mouse
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy Hgf (Mouse) Recombinant Protein now

Add to cart