HGF (Human) Recombinant Protein View larger

HGF (Human) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HGF (Human) Recombinant Protein

BrandAbnova
Product typeProteins
ReactivityHuman
Host speciesInsect
ApplicationsFunc,SDS-PAGE

More info about HGF (Human) Recombinant Protein

Brand: Abnova
Reference: P6021
Product name: HGF (Human) Recombinant Protein
Product description: Human HGF (P14210) full length recombinant protein expressed in Hi-5 (BTI-Tn-5B1-4) Insect cells.
Gene id: 3082
Gene name: HGF
Gene alias: F-TCF|HGFB|HPTA|SF
Gene description: hepatocyte growth factor (hepapoietin A; scatter factor)
Immunogen sequence/protein sequence: alpha chain:
QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLR
beta chain:
VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS
Protein accession: P14210
Form: Lyophilized
Preparation method: Insect cell (Hi-5) expression system
Recommend dilutions: Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein
Storage instruction: Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Tag: None
Product type: Proteins
Host species: Insect
Antigen species / target species: Human
Reactivity: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy HGF (Human) Recombinant Protein now

Add to cart