Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CCL21 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Reactivity | Human,Monkey,Mouse |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about CCL21 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P5980 |
| Product name: | CCL21 (Human) Recombinant Protein |
| Product description: | Human CCL21 (O00585) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 6366 |
| Gene name: | CCL21 |
| Gene alias: | 6Ckine|CKb9|ECL|MGC34555|SCYA21|SLC|TCA4 |
| Gene description: | chemokine (C-C motif) ligand 21 |
| Immunogen sequence/protein sequence: | SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCRKTERSQTPKGP |
| Protein accession: | O00585 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Reactivity: | Human,Monkey,Mouse |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |