Brand | Abnova |
Product type | Proteins |
Reactivity | Human,Mouse |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P5959 |
Product name: | CXCL14 (Human) Recombinant Protein |
Product description: | Human CXCL14 (O95715) partial recombinant protein expressed in Escherichia coli. |
Gene id: | 9547 |
Gene name: | CXCL14 |
Gene alias: | BMAC|BRAK|KS1|Kec|MGC10687|MIP-2g|NJAC|SCYB14|bolekine |
Gene description: | chemokine (C-X-C motif) ligand 14 |
Immunogen sequence/protein sequence: | SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
Protein accession: | O95715 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein |
Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |