Brand | Abnova |
Product type | Proteins |
Reactivity | Human |
Host species | Human |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P5953 |
Product name: | BMP10 (Human) Recombinant Protein |
Product description: | Human BMP10 (O95393, 317 a.a. - 424 a.a.) partial recombinant protein expressed in HEK293 cells. |
Gene id: | 27302 |
Gene name: | BMP10 |
Gene alias: | MGC126783 |
Gene description: | bone morphogenetic protein 10 |
Immunogen sequence/protein sequence: | NAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR |
Protein accession: | O95393 |
Form: | Lyophilized |
Preparation method: | Mammalian cell (HEK293) expression system |
Recommend dilutions: | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage buffer: | Lyophilized from solutions contain no sodiun azide nor carrier protein |
Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Tag: | None |
Product type: | Proteins |
Host species: | Human |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |