APOE (E4) (Human) Recombinant Protein View larger

APOE (E4) (Human) Recombinant Protein

New product

309,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOE (E4) (Human) Recombinant Protein

BrandAbnova
Product typeProteins
ReactivityHuman
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about APOE (E4) (Human) Recombinant Protein

Brand: Abnova
Reference: P5945
Product name: APOE (E4) (Human) Recombinant Protein
Product description: Human APOE (E4) (P02649) partial recombinant protein expressed in Escherichia coli.
Gene id: 348
Gene name: APOE
Gene alias: AD2|LPG|MGC1571|apoprotein
Gene description: apolipoprotein E
Immunogen sequence/protein sequence: MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH
Protein accession: P02649
Form: Lyophilized
Preparation method: Escherichia coli expression system
Recommend dilutions: SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein
Storage instruction: Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Reactivity: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy APOE (E4) (Human) Recombinant Protein now

Add to cart