Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DKK2 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about DKK2 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P5865 |
| Product name: | DKK2 (Human) Recombinant Protein |
| Product description: | Human DKK2 (NP_055236, 34 a.a. - 259 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 27123 |
| Gene name: | DKK2 |
| Gene alias: | DKK-2 |
| Gene description: | dickkopf homolog 2 (Xenopus laevis) |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMGSMKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI |
| Form: | Liquid |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20mM Tris-HCl buffer, pH 8.0 (0.4M Urea, 10% glycerol). |
| Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed. |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |