MCL1 (Human) Recombinant Protein View larger

MCL1 (Human) Recombinant Protein

New product

439,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MCL1 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about MCL1 (Human) Recombinant Protein

Brand: Abnova
Reference: P5864
Product name: MCL1 (Human) Recombinant Protein
Product description: Human MCL1 (NP_068779, 1 a.a. - 327 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Gene id: 4170
Gene name: MCL1
Gene alias: BCL2L3|EAT|MCL1L|MCL1S|MGC104264|MGC1839|TM
Gene description: myeloid cell leukemia sequence 1 (BCL2-related)
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG
Form: Liquid
Preparation method: Escherichia coli expression system
Storage buffer: In 20mM Tris-HCl buffer, pH 8.0 (0.2M NaCl, 20% glycerol, 2mM DTT).
Storage instruction: Store at 4°C. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Quality control testing picture: qc_test-P5864-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy MCL1 (Human) Recombinant Protein now

Add to cart