EMCN (Human) Recombinant Protein View larger

EMCN (Human) Recombinant Protein

New product

359,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EMCN (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about EMCN (Human) Recombinant Protein

Brand: Abnova
Reference: P5853
Product name: EMCN (Human) Recombinant Protein
Product description: Human EMCN (NP_057326, 19 a.a. - 190 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Gene id: 51705
Gene name: EMCN
Gene alias: EMCN2|MUC14
Gene description: endomucin
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMGSHMNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGSVLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSS
Form: Liquid
Preparation method: Escherichia coli expression system
Storage buffer: In 20mM Tris-HCl buffer, pH 8.0 (10% glycerol, 1mM DTT, 100mM NaCl).
Storage instruction: Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Quality control testing picture: qc_test-P5853-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy EMCN (Human) Recombinant Protein now

Add to cart