PAK4 (Human) Recombinant Protein View larger

PAK4 (Human) Recombinant Protein

New product

469,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAK4 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about PAK4 (Human) Recombinant Protein

Brand: Abnova
Reference: P5384
Product name: PAK4 (Human) Recombinant Protein
Product description: Human PAK4 kinase domain (O96013, 300 a.a. - 591 a.a.) partial recombinant protein expressed in Escherichia coli.
Gene id: 10298
Gene name: PAK4
Gene alias: -
Gene description: p21 protein (Cdc42/Rac)-activated kinase 4
Immunogen sequence/protein sequence: GPHMSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
The first 4 residues GPHM are from Turbo3C Protease cleavage site. The underlined S is phosphorylated S474.
Protein accession: O96013
Form: Liquid
Concentration: 1 mg/ml
Preparation method: Escherichia coli expression system
Storage buffer: In 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Storage instruction: Store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 7 ug protein in SDS-PAGE
Quality control testing picture: qc_test-P5384-1.jpg
Note: Result of activity analysis
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy PAK4 (Human) Recombinant Protein now

Add to cart