PAK1 (Human) Recombinant Protein View larger

PAK1 (Human) Recombinant Protein

New product

510,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAK1 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about PAK1 (Human) Recombinant Protein

Brand: Abnova
Reference: P5382
Product name: PAK1 (Human) Recombinant Protein
Product description: Human PAK1 kinase domain (Q13153, 248 a.a. - 545 a.a.) partial recombinant protein expressed in Escherichia coli. The recombinant protein does not have the inhibitory switch domain and has high specific activity.
Gene id: 5058
Gene name: PAK1
Gene alias: MGC130000|MGC130001|PAKalpha
Gene description: p21 protein (Cdc42/Rac)-activated kinase 1
Immunogen sequence/protein sequence: GPHMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH
The first 4 residues GPHM are from Turbo3C Protease cleavage site. The underlined T is phosphorylated T423.
Protein accession: Q13153
Form: Liquid
Concentration: 1 mg/ml
Preparation method: Escherichia coli expression system
Storage buffer: In 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Storage instruction: Store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 8 ug protein in SDS-PAGE
Quality control testing picture: qc_test-P5382-1.jpg
Note: Result of activity analysis
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice
Publications: Pak1 Kinase Maintains Apical Membrane Identity in Epithelia.Aguilar-Aragon M, Elbediwy A, Foglizzo V, Fletcher GC, Li VSW, Thompson BJ.
Cell Rep. 2018 Feb 13;22(7):1639-1646.

Reviews

Buy PAK1 (Human) Recombinant Protein now

Add to cart