Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SAA1 (Monkey) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about SAA1 (Monkey) Recombinant Protein
| Brand: | Abnova |
| Reference: | P5185 |
| Product name: | SAA1 (Monkey) Recombinant Protein |
| Product description: | Monkey SAA1 (P02738, 104 amino acids) partial recombinant expressed in Escherichia coli. |
| Gene id: | 694827 |
| Gene name: | SAA1 |
| Gene alias: | - |
| Gene description: | serum amyloid A1 |
| Immunogen sequence/protein sequence: | RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPGGVWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Protein accession: | P02738 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | Lyophilized from PBS pH 7.4 |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Monkey |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |