Ifng (Rat) Recombinant Protein View larger

Ifng (Rat) Recombinant Protein

New product

309,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Ifng (Rat) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about Ifng (Rat) Recombinant Protein

Brand: Abnova
Reference: P5152
Product name: Ifng (Rat) Recombinant Protein
Product description: Rat Ifng (P01581) recombinant protein expressed in Escherichia coli.
Gene id: 25712
Gene name: Ifng
Gene alias: IFNG2
Gene description: interferon gamma
Immunogen sequence/protein sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Protein accession: P01581
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: Lyophilized from PBS, pH 7.0
Storage instruction: Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Rat
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy Ifng (Rat) Recombinant Protein now

Add to cart