Reference: | P5003 |
Product name: | grxB (Escherichia coli (E. coli)) Recombinant Protein |
Product description: | Escherichia coli (E. coli) grxB (NP_415582, 1 a.a. - 215 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli (E. coli). |
Gene id: | 946926 |
Gene name: | grxB |
Gene alias: | ECK1049|JW1051 |
Gene description: | glutaredoxin 2 (Grx2) |
Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMKLYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI |
Protein accession: | NP_415582 |
Form: | Liquid |
Concentration: | 1 mg/mL |
Preparation method: | Escherichia coli (E. coli) expression system |
Storage buffer: | In 20 mM Tris-HCl, 50 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol) |
Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
Tag: | His |
Shipping condition: | Dry Ice |