Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of deoC (Escherichia coli (E. coli)) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Origin species | Escherichia coli (E. coli) |
| Host species | Escherichia coli (E. coli) |
| Applications | SDS-PAGE |
More info about deoC (Escherichia coli (E. coli)) Recombinant Protein
| Reference: | P4996 |
| Product name: | deoC (Escherichia coli (E. coli)) Recombinant Protein |
| Product description: | Escherichia coli (E. coli) deoC (NP_418798, 1 a.a. - 259 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli (E. coli). |
| Gene id: | 948902 |
| Gene name: | deoC |
| Gene alias: | ECK4373|JW4344|dra|thyR|tlr |
| Gene description: | 2-deoxyribose-5-phosphate aldolase, NAD(P)-linked |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGHGDGKSASSY |
| Protein accession: | NP_418798 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli (E. coli) expression system |
| Storage buffer: | In 20 mM Tris-HCl, pH 8.0 (2 mM DTT, 10% glycerol) |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Tag: | His |
| Shipping condition: | Dry Ice |