> >>Streptavidin (Streptomyces avidinii) Recombinant Protein
Streptavidin (Streptomyces avidinii) Recombinant Protein View larger

Streptavidin (Streptomyces avidinii) Recombinant Protein

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of Streptavidin (Streptomyces avidinii) Recombinant Protein

BrandAbnova
Product typeProteins
Origin speciesBacteria
Host speciesEscherichia coli (E. coli)
ApplicationsSDS-PAGE

More info about Streptavidin (Streptomyces avidinii) Recombinant Protein

Reference: P4990
Product name: Streptavidin (Streptomyces avidinii) Recombinant Protein
Product description: Streptomyces avidinii Streptavidin (CAA27265, P22629, 25 a.a. - 183 a.a.) partial recombinant protein with His tag expressed in Escherichia coli (E. coli).
Immunogen sequence/protein sequence: MVHHHHHHDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Protein accession: CAA27265, P22629
Form: Liquid
Concentration: 1 mg/mL
Preparation method: Escherichia coli (E. coli) expression system
Storage buffer: In 20 mM Tris, pH 7.5
Storage instruction: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 3 ug protein in 15% SDS-PAGE
Tag: His
Shipping condition: Dry Ice

Reviews

Buy Streptavidin (Streptomyces avidinii) Recombinant Protein now

Add to cart