GST (Schistosoma japonicum) Recombinant Protein View larger

GST (Schistosoma japonicum) Recombinant Protein

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GST (Schistosoma japonicum) Recombinant Protein

BrandAbnova
Product typeProteins
Origin speciesS. japonicum
Host speciesEscherichia coli (E. coli)
ApplicationsSDS-PAGE

More info about GST (Schistosoma japonicum) Recombinant Protein

Reference: P4988
Product name: GST (Schistosoma japonicum) Recombinant Protein
Product description: Schistosoma japonicum GST (NP_ P08515, 1 a.a. - 224 a.a.) full-length recombinant protein expressed in Escherichia coli (E. coli).
Immunogen sequence/protein sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPR
Protein accession: NP_ P08515
Form: Liquid
Concentration: 1 mg/mL
Preparation method: Escherichia coli (E. coli) expression system
Storage buffer: In PBS, pH 7.4
Storage instruction: Store at 4°C. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 3 ug protein in 15% SDS-PAGE
Tag: None
Shipping condition: Dry Ice

Reviews

Buy GST (Schistosoma japonicum) Recombinant Protein now

Add to cart