Reference: | P4969 |
Product name: | dsbC (Escherichia coli (E. coli)) Recombinant protein |
Product description: | Escherichia coli (E. coli) dsbC (YP_003045913, 20 a.a. - 208 a.a.) partial recombinant protein expressed in Escherichia coli (E. coli). |
Gene id: | 8177108 |
Immunogen sequence/protein sequence: | DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYVLGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK |
Protein accession: | YP_003045913 |
Form: | Liquid |
Concentration: | 1 mg/mL |
Preparation method: | Escherichia coli (E. coli) expression system |
Storage buffer: | In 20 mM Tris, pH 7.5 (2 mM EDTA) |
Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 15% SDS-PAGE Stained with Coomassie Blue |
Tag: | None |
Shipping condition: | Dry Ice |