Reference: | P4962 |
Product name: | dnaK (Escherichia coli (E. coli)) Recombinant protein |
Product description: | Escherichia coli (E. coli) dnaK (NP_414555, 385 a.a. - 546 a.a.) partial recombinant protein expressed in Escherichia coli (E. coli). |
Gene id: | 944750 |
Gene name: | dnaK |
Gene alias: | ECK0014|JW0013|groPAB|groPC|groPF|grpC|grpF|seg |
Gene description: | chaperone Hsp70, co-chaperone with DnaJ |
Immunogen sequence/protein sequence: | MDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHST |
Protein accession: | NP_414555 |
Form: | Liquid |
Concentration: | 1 mg/mL |
Preparation method: | Escherichia coli (E. coli) expression system |
Storage buffer: | In 25 mM Tris-HCl, pH 7.5 (2 mM 2-ME, 1 mM EDTA) |
Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 15% SDS-PAGE Stained with Coomassie Blue |
Tag: | None |
Shipping condition: | Dry Ice |