Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TNFRSF4 (Human) Recombinanat Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Hamster |
| Applications | SDS-PAGE |
More info about TNFRSF4 (Human) Recombinanat Protein
| Brand: | Abnova |
| Reference: | P4934 |
| Product name: | TNFRSF4 (Human) Recombinanat Protein |
| Product description: | Human TNFRSF4 recombinanat protein fused to murine IgG2a Fc purifird from CHO cells. |
| Gene id: | 7293 |
| Gene name: | TNFRSF4 |
| Gene alias: | ACT35|CD134|OX40|TXGP1L |
| Gene description: | tumor necrosis factor receptor superfamily, member 4 |
| Immunogen sequence/protein sequence: | TNFRSF4 mature: lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpwtnctlagkhtlqpasnssdaicedrdppatqpqetqgpparpitvqpteawprtsqgpstr Fused to murine IgG2a Fc: eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg |
| Form: | Liquid |
| Concentration: | 0.5 mg/mL |
| Preparation method: | Mammalian cell (CHO) expression system |
| Storage buffer: | In 50 mM sodium phosphate, 100 mM NaCl, pH 7.6. (0.5 mg/mL gentamicin sulfate) |
| Storage instruction: | Store at 4°C. This product is stable for at least 3 months. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Hamster |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Blue Ice |