UNC119B (Human) Recombinant Protein View larger

UNC119B (Human) Recombinant Protein

New product

439,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UNC119B (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about UNC119B (Human) Recombinant Protein

Brand: Abnova
Reference: P4909
Product name: UNC119B (Human) Recombinant Protein
Product description: Human UNC119B (NP_001074002, 1 a.a. - 251 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Gene id: 84747
Gene name: UNC119B
Gene alias: MGC5139
Gene description: unc-119 homolog B (C. elegans)
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRPEHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFVRYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADYAYNGGQ
Protein accession: NP_001074002
Form: Liquid
Concentration: 0.5 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol)
Storage instruction: Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 15% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-P4909-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy UNC119B (Human) Recombinant Protein now

Add to cart