Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HBsAg (preS2) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about HBsAg (preS2) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4877 |
| Product name: | HBsAg (preS2) Recombinant Protein |
| Product description: | HBsAg preS2 (AAK51534, 55 amino acids) recombinanat protein expressed in Escherichia coli. |
| Immunogen sequence/protein sequence: | MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN |
| Protein accession: | AAK51534 |
| Form: | Liquid |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM PB, 50 mM NaCl pH 7.4 |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Viruses |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |