Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GSK3B (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Insect |
| Applications | Func,SDS-PAGE |
More info about GSK3B (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4698 |
| Product name: | GSK3B (Human) Recombinant Protein |
| Product description: | Human GSK3B (NP_001139628.1, 1 a.a.- 420 a.a.) full-length recombinant protein with GST-His tag expressed in Sf9 cells. |
| Gene id: | 2932 |
| Gene name: | GSK3B |
| Gene alias: | - |
| Gene description: | glycogen synthase kinase 3 beta |
| Immunogen sequence/protein sequence: | MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST |
| Protein accession: | NP_001139628.1 |
| Form: | Liquid |
| Concentration: | 0.276 ug/Ul |
| Preparation method: | Insect cell (Sf9) expression system |
| Storage buffer: | In 50 mM Hepes, 100 mM NaCl, pH 7.5. (5 mM DTT, 15 mM reduced glutathione, 20% glycerol) |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing |
| Quality control testing: | 2 ug/lane SDS-PAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Note: | Result of activity analysis |
| Tag: | GST-His |
| Product type: | Proteins |
| Host species: | Insect |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |