Il21 (Mouse) Recombinant Protein View larger

Il21 (Mouse) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Il21 (Mouse) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about Il21 (Mouse) Recombinant Protein

Brand: Abnova
Reference: P4631
Product name: Il21 (Mouse) Recombinant Protein
Product description: Mouse Il21 (Q9ES17) recombinant protein expressed in Escherichia coli.
Gene id: 60505
Gene name: Il21
Gene alias: -
Gene description: interleukin 21
Immunogen sequence/protein sequence: MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Protein accession: Q9ES17
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: Lyophilized with 20 mM NaHCO3, pH 8.5.
Storage instruction: Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing picture: note-P4631-1.jpg
Quality control testing picture note: Serial dilutions of mouse Il21 (starting at 100 ng/mL) or ConA (+ control) were added to primary mouse thymocytes cultured on an anti-cD3e coated plate. After 72 hours, total live thymoctyes were measured and the linear portion of the curve was us used to calculate the ED50.
Note: Result of activity analysis
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Mouse
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy Il21 (Mouse) Recombinant Protein now

Add to cart